Welcome to TøybleieRumpa
NOK Currency
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Kategori
Handlekurv
0
Product Details
All inn One tøybleie med knapper - LilleGull og venner
All inn One tøybleie med knapper - LilleGull og venner
All inn One tøybleie med knapper - LilleGull og venner
All inn One tøybleie med knapper - LilleGull og venner

All inn One tøybleie med knapper - LilleGull og venner

Product Code: Onesize
Product Condition: ny
weight: 120.0g
185 kr inkl. mva
 Add to Cart
Description
LilleGull Tøybleier sitt første egendesignede print

LilleGull og venner

Onesize AiO - all inn one tøybleie
med to isydde flapper - Dvs to isydde 4 lag bambusinlegg.

100 % bambusfrotte innside - pul utside
Veiledende størrelse er 4 - 15 kg




Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Related Products
Product Added to your Cart
x

-------- eller --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i